PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00117.1.g00260.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 355aa    MW: 40107.3 Da    PI: 11.8731
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00117.1.g00260.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.83.8e-30207257151
                                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                                   krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
  Zpz_sc00117.1.g00260.1.am.mk 207 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS 257
                                   79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.9E-41199258IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.763199259IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-30201221IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-28201259IPR002100Transcription factor, MADS-box
CDDcd002658.67E-38201257No hitNo description
PROSITE patternPS003500201255IPR002100Transcription factor, MADS-box
PfamPF003197.6E-27208255IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-30221236IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-30236257IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
LRSPRPDPIP QSTSSPSLEK QGRIRSQPPW PGTSVSAHRR RRPMAMRPHY RGGGPACPAR  60
FFPRRVITLR DRLLYLARRD VFYLHAAGHA SPPPHAAARP RHGGFRLRLR VIRSSSIFPC  120
WPAPPATRYR SAAPNLVHSS FHASGRGSTR KETRGEAAVW LRPPPPPAFL ASSLCHFWEC  180
SRVPLDSHFR ERTRRSARMV RGKTEMKRIE NATSRQVTFS KRRNGLLKKA FELSVLCDAE  240
VALIVFSPRG KLYEFASAAR CVCRSISSPP SLFTRPLLLS SRRVSHESAD CKSNSVSFRF  300
ELALRRGYLS LLMHICGIEY SSISSNAESP PVRRAQHPQA QLCERCGYYL KPELL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D6e-16201257258Myocyte-specific enhancer factor 2A
3mu6_C6e-16201257258Myocyte-specific enhancer factor 2A
3mu6_B6e-16201257258Myocyte-specific enhancer factor 2A
3mu6_A6e-16201257258Myocyte-specific enhancer factor 2A
1egw_D8e-16201257258MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C8e-16201257258MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B8e-16201257258MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A8e-16201257258MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J1e-15201257258Myocyte-specific enhancer factor 2A
3p57_I1e-15201257258Myocyte-specific enhancer factor 2A
3p57_D1e-15201257258Myocyte-specific enhancer factor 2A
3p57_C1e-15201257258Myocyte-specific enhancer factor 2A
3p57_B1e-15201257258Myocyte-specific enhancer factor 2A
3p57_A1e-15201257258Myocyte-specific enhancer factor 2A
3kov_J1e-15201257258Myocyte-specific enhancer factor 2A
3kov_I1e-15201257258Myocyte-specific enhancer factor 2A
3kov_B1e-15201257258Myocyte-specific enhancer factor 2A
3kov_A1e-15201257258Myocyte-specific enhancer factor 2A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0648233e-65BT064823.1 Zea mays full-length cDNA clone ZM_BFb0180I10 mRNA, complete cds.
GenBankEU9610133e-65EU961013.1 Zea mays clone 230445 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4777323
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.13e-34AGAMOUS-like 14